Analytical Data
-
Gene name
ANKRD30A
- Application
-
Alternative Names
ANKRD30AAnkyrin repeat domain-containing Protein 30A; Serologically defined breast cancer antigen NY-BR-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BXX3
-
Expression Region
948-1055aa
-
AA Sequence
SEAKEIKSQLENQKVKWEQELCSVRLTLNQEEEKRRNADILNEKIREELGRIEEQHRKELEVKQQLEQALRIQDIELKSVESNLNQVSHTHENENYLLHENCMLKKEI
-
Molecular Weight
37.62 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ANKRD30A, a member of the ankyrin repeat domain protein family, has garnered attention in recent years due to its potential roles in various biological processes, including cellular signaling, immune response, and developmental regulation. The expression of ANKRD30A is often associated with specific cellular contexts, such as stress responses and inflammatory conditions, indicating its involvement in pathophysiological states. Studies have suggested that ANKRD30A may interact with key proteins in cell signaling pathways, thereby influencing downstream effects on cellular functions. This makes it a candidate for further investigation as a biomarker or therapeutic target in diseases such as cancer and autoimmune disorders. Research involving the recombinant expression of ANKRD30A has enabled scientists to study its structure and function in detail, ultimately leading to a better understanding of its role in physiological and pathological processes. Investigating the protein's interactions and mechanisms of action could provide insights into its contributions to human health and disease, paving the way for novel therapeutic strategies. Moreover, the recombinant production of ANKRD30A facilitates high-throughput screening and functional assays, accelerating its application in drug discovery and development. Overall, ongoing research into ANKRD30A is crucial for uncovering its biological significance and potential clinical applications.
