Analytical Data
-
Gene name
OR6C76
- Application
-
Alternative Names
OR6C76; Olfactory receptor 6C76
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6NM76
-
Expression Region
1-312 aa
-
AA Sequence
MKNRTSVTDFILLGLTDNPQLQVVIFSFLFLTYVLSVTGNLTIISLTLLDSHLKTPMYFF LRNFSLEISFTSVCNPRFLISILTGDKSISYNACAAQLFFFIFLGSTEFFLLASMSYDCY VAICKPLHYTTIMSDRICYQLIISSWLAGFLVIFPPLAMGLQLDFCDSNVIDHFTCDSAP LLQISCTDTSTLELMSFILALFTLISTLILVILSYTYIIRTILRIPSAQQRKKAFSTCSS HVIVVSISYGSCIFMYVKTSAKEGVALTKGVAILNTSVAPMLNPFIYTLRNQQVKQAFKD VLRKISHKKKKH
-
Molecular Weight
35.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR6C76 protein, a member of the olfactory receptor gene family, has garnered attention in recent research due to its potential role in chemosensation and its implications in sensory biology. Olfactory receptors are critical for the perception of odors, yet the functions of many, including OR6C76, remain largely unexplored. This receptor is expressed in various tissues, suggesting it may participate in non-olfactory functions as well. Recent studies focused on deciphering its ligand specificity and signaling pathways have revealed intriguing connections between olfactory receptors and other physiological processes. Additionally, the involvement of olfactory receptors in diseases such as asthma and allergies underscores the importance of understanding their mechanisms. By producing a recombinant form of OR6C76, researchers aim to investigate its functional properties in detail, which could lead to novel insights into sensory mechanisms and potentially therapeutic applications. The recombinant protein allows for controlled studies of receptor interactions and responses, providing a valuable tool for elucidating the complex biology of olfactory signaling and its contribution to the overall sensory experience.
