Analytical Data
-
Gene name
OR5J2
- Application
-
Alternative Names
OR5J2; Olfactory receptor 5J2; Olfactory receptor OR11-266
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NH18
-
Expression Region
1-312 aa
-
AA Sequence
MADDNFTVVTEFILLGLTDHAELKAVLFVVFLVIYAITLLRNLGMILLIQITSKLHTPMY FLLSCLSFVDACYSSAIAPKMLVNLLVVKATISFSACMVQHLCFGVFITTEGFLLSVMAY DRYVAIVSPLLYTVAMSDRKCVELVTGSWIGGIVNTLIHTISLRRLSFCRLNAVSHFFCD IPSLLKLSCSDTSMNELLLLTFSGVIAMATFLTVIISYIFIAFASLRIHSASGRQQAFST CASHLTAVTIFYGTLIFSYIQPSSQYFVEQEKVVSMFYTLGIPMLNLLIHSLRNKDVKEA VKRAIEMKHFLC
-
Molecular Weight
34.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR5J2 protein, a member of the olfactory receptor family, plays a crucial role in the sensory perception of odors. This family of G-protein-coupled receptors is primarily involved in the detection of volatile compounds, thereby mediating the sense of smell. Recent studies highlight the significance of OR5J2 in various physiological processes, as well as its potential implications in neurobiology and sensory disorders. The reconstitution of OR5J2 as a recombinant protein is essential for investigating its structure-function relationships and understanding its signaling mechanisms. Such research could elucidate how genetic variations in the OR5J2 gene impact olfactory sensitivity and contribute to individual differences in smell perception. Furthermore, OR5J2 is being explored for its role in certain conditions, including the influence of olfactory dysfunction on mood disorders and neurodegenerative diseases. The study of OR5J2 not only contributes to the broader understanding of olfactory biology but also holds potential for the development of novel therapeutic strategies targeting olfactory pathways and improving sensory capabilities. Overall, the investigation of OR5J2 recombinant proteins is a vital step in advancing the knowledge of olfactory receptor functionality and its relevance in health and disease.
