Cat: PA2000-9987

Recombinant Human OR5H6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OR5H6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OR5H6; Olfactory receptor 5H6; Olfactory receptor OR3-11

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NGV6

  • Expression Region

    1-325 aa

  • AA Sequence

    MFLYLCFIFQRTCSEEMEEENATLLTEFVLTGFLHQPDCKIPLFLAFLVIYLITIMGNLG LIVLIWKDPHLHIPMYLFLGSLAFVDASLSSTVTPKMLINFLAKSKMISLSECMVQFFSL VTTVTTECFLLATMAYDRYVAICKALLYPVIMTNELCIQLLVLSFIGGLLHALIHEAFSF RLTFCNSNIIQHFYCDIIPLLKISCTDSSINFLMVFIFAGSVQVFTIGTILISYTIILFT ILEKKSIKGIRKAVSTCGAHLLSVSLYYGPLTFKYLGSASPQADDQDMMESLFYTVIVPL LNPMIYSLRNKQVIASFTKMFKSNV

  • Molecular Weight

    36.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The OR5H6 protein, a member of the olfactory receptor family, plays a crucial role in the detection of volatile odorant molecules, contributing to the sense of smell in humans and other mammals. Olfactory receptors are G-protein-coupled receptors (GPCRs) that are heavily involved in the neurobiological mechanisms of olfaction, impacting behaviors and physiological responses related to scent. Recent studies have highlighted the importance of the OR5H6 receptor in recognizing specific odorants, which may influence both social and environmental interactions. Research on OR5H6 has garnered interest not only for its fundamental biological significance but also for its potential implications in understanding odor-related disorders and enhancing flavor profiles in food science. Furthermore, the recombinantly expressed OR5H6 protein allows for detailed biochemical and pharmacological studies, facilitating the elucidation of its specific signaling pathways and structural characteristics. This synthetic approach provides a valuable tool for advancing our knowledge of olfactory receptor functions, enabling the exploration of their roles beyond mere sensory perception, including their involvement in various neurological and psychological processes. As olfactory receptors like OR5H6 continue to reveal their complex functionalities, they present novel avenues for therapeutic interventions and biotechnological applications related to sensory processes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US