Analytical Data
-
Gene name
OR5H6
- Application
-
Alternative Names
OR5H6; Olfactory receptor 5H6; Olfactory receptor OR3-11
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGV6
-
Expression Region
1-325 aa
-
AA Sequence
MFLYLCFIFQRTCSEEMEEENATLLTEFVLTGFLHQPDCKIPLFLAFLVIYLITIMGNLG LIVLIWKDPHLHIPMYLFLGSLAFVDASLSSTVTPKMLINFLAKSKMISLSECMVQFFSL VTTVTTECFLLATMAYDRYVAICKALLYPVIMTNELCIQLLVLSFIGGLLHALIHEAFSF RLTFCNSNIIQHFYCDIIPLLKISCTDSSINFLMVFIFAGSVQVFTIGTILISYTIILFT ILEKKSIKGIRKAVSTCGAHLLSVSLYYGPLTFKYLGSASPQADDQDMMESLFYTVIVPL LNPMIYSLRNKQVIASFTKMFKSNV
-
Molecular Weight
36.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR5H6 protein, a member of the olfactory receptor family, plays a crucial role in the detection of volatile odorant molecules, contributing to the sense of smell in humans and other mammals. Olfactory receptors are G-protein-coupled receptors (GPCRs) that are heavily involved in the neurobiological mechanisms of olfaction, impacting behaviors and physiological responses related to scent. Recent studies have highlighted the importance of the OR5H6 receptor in recognizing specific odorants, which may influence both social and environmental interactions. Research on OR5H6 has garnered interest not only for its fundamental biological significance but also for its potential implications in understanding odor-related disorders and enhancing flavor profiles in food science. Furthermore, the recombinantly expressed OR5H6 protein allows for detailed biochemical and pharmacological studies, facilitating the elucidation of its specific signaling pathways and structural characteristics. This synthetic approach provides a valuable tool for advancing our knowledge of olfactory receptor functions, enabling the exploration of their roles beyond mere sensory perception, including their involvement in various neurological and psychological processes. As olfactory receptors like OR5H6 continue to reveal their complex functionalities, they present novel avenues for therapeutic interventions and biotechnological applications related to sensory processes.
