Analytical Data
-
Gene name
ANGPTL1
- Application
-
Alternative Names
ANG 3; ANG-3; ANG3; Angioarrestin; Angiopoietin 3; Angiopoietin like 1; Angiopoietin like Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95841
-
Expression Region
24-491aa
-
AA Sequence
GQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDASTIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLSNQDNYKLLIELEDWSDKKVYAEYSSFRLEPESEFYRLRLGTYQGNAGDSMMWHNGKQFTTLDRDKDMYAGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRAVQMMIKPID
-
Molecular Weight
77.22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ANGPTL1 (Angiopoietin-like protein 1) is a member of the angiopoietin-like family, playing a crucial role in various physiological processes, including angiogenesis, metabolism, and inflammation. Research has increasingly focused on ANGPTL1 due to its implications in cardiovascular diseases and metabolic disorders. It has been shown to modulate lipid metabolism by inhibiting lipoprotein lipase (LPL), which impacts triglyceride levels and energy homeostasis. Emerging evidence suggests that ANGPTL1 may also influence cellular signaling pathways related to inflammation and endothelial function, positioning it as a potential therapeutic target for treating conditions such as atherosclerosis and obesity. The recombinant production of ANGPTL1 protein allows for in-depth studies of its structure-function relationships and biological roles, facilitating the exploration of its therapeutic potential. Understanding the mechanisms through which ANGPTL1 exerts its effects can offer novel insights into disease mechanisms and lead to the development of new treatments for related disorders. Thus, the study of ANGPTL1 recombinant protein is essential for unraveling its complex biology and therapeutic applications.
