Analytical Data
-
Gene name
OR5F1
- Application
-
Alternative Names
OR5F1; Olfactory receptor 5F1; Olfactory receptor 11-10; OR11-10; Olfactory receptor OR11-167
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95221
-
Expression Region
1-314 aa
-
AA Sequence
MTRKNYTSLTEFVLLGLADTLELQIILFLFFLVIYTLTVLGNLGMILLIRIDSQLHTPMY FFLANLSFVDVCNSTTITPKMLADLLSEKKTISFAGCFLQMYFFISLATTECILFGLMAY DRYAAICRPLLYSLIMSRTVYLKMAAGAFAAGLLNFMVNTSHVSSLSFCDSNVIHHFFCD SPPLFKLSCSDTILKESISSILAGVNIVGTLLVILSSYSYVLFSIFSMHSGEGRHRAFST CASHLTAIILFYATCIYTYLRPSSSYSLNQDKVASVFYTVVIPMLNPLIYSLRSKEVKKA LANVISRKRTSSFL
-
Molecular Weight
35.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR5F1 gene encodes a member of the olfactory receptor (OR) family, which plays a crucial role in the sense of smell by detecting volatile compounds. As part of the largest gene family in the human genome, ORs like OR5F1 are characterized by their G-protein-coupled receptor (GPCR) structure, which allows them to transduce chemical signals into neuronal responses. Research into OR5F1 has garnered interest due to its potential implications in understanding olfactory perception, as well as its involvement in certain physiological and pathological processes. Studies have suggested that variations in OR5F1 may influence individual differences in scent perception, which can affect behaviors and preferences. Furthermore, olfactory receptors are being explored for their therapeutic potential, including in cancer treatment and drug development. As a result, the recombinant expression of OR5F1 protein has become a focal point for researchers aiming to elucidate the functional mechanisms of this receptor. By creating and analyzing the recombinant OR5F1 protein, scientists can better understand its binding affinities, signaling pathways, and interactions with various ligands, ultimately contributing to a greater understanding of olfactory signaling and its broader biological ramifications. The research on OR5F1 thus holds promise not only in the field of sensory biology but also in advancing applications in biotechnology and medicine.
