Analytical Data
-
Gene name
ANGEL2
- Application
-
Alternative Names
ANGEL2; KIAA0759LProtein angel homolog 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VTE6
-
Expression Region
1-286aa
-
AA Sequence
MSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIKHFDADVLCLQEVQEDHYGAEIRPSLESLGYHCEYKMRTGRKPDGCAICFKHSKFSLLSVNPVEFFRPDISLLDRDNVGLVLLLQPKIPYAACPAICVANTHLLYNPRRGDIKLTQLAMLLAEISSVAHQKDGSFCPIVMCGDFNSVPGSPLYSFIKEGKLNYEGLPIGKVSGQEQSSRGQRILSIPIWPPNLGISQNCVYEVQQVPKVEKTDSDLTQTQLKQTEVLVTAEKLSSNLQHHFSLSSVY
-
Molecular Weight
58.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ANGEL2, an intriguing member of the ANGEL family of proteins, has garnered significant attention in the field of molecular biology due to its potential role in regulating various cellular processes, including stress response, apoptosis, and signal transduction. The ANGEL proteins, characterized by their RNA-binding capabilities, are thought to be involved in the modulation of gene expression at the post-transcriptional level. Recent studies have indicated that ANGEL2 may play a crucial role in neurological functions and could be implicated in neurodegenerative diseases, highlighting its importance in both health and disease contexts. The recombinant expression of ANGEL2 is pivotal for elucidating its functional properties and interactions with other cellular molecules. By producing ANGEL2 as a recombinant protein, researchers can generate antibodies, assess its biochemical characteristics, and investigate its biological activities in various experimental settings. This research not only aims to deepen our understanding of ANGEL2's mechanisms of action but also to explore its potential as a therapeutic target or biomarker in related pathologies. As scientists continue to explore the complexities of ANGEL2, its study promises to illuminate new dimensions in the intricate web of cellular signaling and regulation.
