Analytical Data
-
Gene name
OR5D16
- Application
-
Alternative Names
OR5D16; Olfactory receptor 5D16; Olfactory receptor OR11-154
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGK9
-
Expression Region
1-328 aa
-
AA Sequence
MFLTERNTTSEATFTLLGFSDYLELQIPLFFVFLAVYGFSVVGNLGMIVIIKINPKLHTP MYFFLNHLSFVDFCYSSIIAPMMLVNLVVEDRTISFSGCLVQFFFFCTFVVTELILFAVM AYDHFVAICNPLLYTVAISQKLCAMLVVVLYAWGVACSLTLACSALKLSFHGFNTINHFF CELSSLISLSYPDSYLSQLLLFTVATFNEISTLLIILTSYAFIIVTTLKMPSASGHRKVF STCASHLTAITIFHGTILFLYCVPNSKNSRHTVKVASVFYTVVIPLLNPLIYSLRNKDVK DAIRKIINTKYFHIKHRHWYPFNFVIEQ
-
Molecular Weight
37.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR5D16, a member of the olfactory receptor family, has garnered significant interest in the field of neuroscience and pharmacology due to its potential role in sensory perception and human physiology. As a G protein-coupled receptor, OR5D16 is primarily involved in olfactory signaling, which is fundamental for the detection of various odorants and environmental cues. Recent studies have highlighted its expression in non-olfactory tissues, suggesting a broader physiological role that extends beyond traditional scent perception. The investigation of OR5D16 recombinant proteins is crucial for understanding its functional mechanisms, ligand specificity, and potential therapeutic applications. By employing recombinant DNA technologies, researchers are able to express and purify OR5D16, allowing for detailed analyses of its structure-function relationships and interaction with various ligands. Moreover, exploring the signaling pathways activated by OR5D16 could provide insights into its contribution to neurological disorders and metabolic processes. The characterization of OR5D16, therefore, represents a promising avenue for unraveling the complexities of olfactory signaling and devising novel strategies for drug development targeting sensory and non-sensory pathways.
