Analytical Data
-
Gene name
OR5D14
- Application
-
Alternative Names
OR5D14; Olfactory receptor 5D14; Olfactory receptor OR11-141; Olfactory receptor OR11-150
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGL3
-
Expression Region
1-314 aa
-
AA Sequence
MMMVLRNLSMEPTFALLGFTDYPKLQIPLFLVFLLMYVITVVGNLGMIIIIKINPKFHTP MYFFLSHLSFVDFCYSSIVTPKLLENLVMADKSIFYFSCMMQYFLSCTAVVTESFLLAVM AYDRFVAICNPLLYTVAMSQRLCALLVAGSYLWGMFGPLVLLCYALRLNFSGPNVINHFF CEYTALISVSGSDILIPHLLLFSFATFNEMCTLLIILTSYVFIFVTVLKIRSVSGRHKAF STWASHLTSITIFHGTILFLYCVPNSKNSRQTVKVASVFYTVVNPMLNPLIYSLRNKDVK DAFWKLIHTQVPFH
-
Molecular Weight
35.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR5D14 is a member of the olfactory receptor (OR) gene family, which plays a crucial role in the sense of smell. As the largest gene family in the human genome, olfactory receptors like OR5D14 are responsible for the detection of a wide range of volatile compounds, contributing to odor perception. Despite its importance, OR5D14 remains relatively understudied compared to other olfactory receptors. Recent research has begun to explore its functional properties, expression patterns, and potential involvement in various physiological and pathological processes. The recombinant protein study of OR5D14 is essential for understanding its structure-function relationship, signaling mechanisms, and interaction with odorants. Additionally, insights gained from OR5D14 research may have implications for developing novel therapeutic strategies for olfactory disorders and enhancing our understanding of the molecular basis of taste and smell. The production of OR5D14 recombinant protein allows for in vitro experimentation and offers the potential to uncover significant information about how this receptor contributes to olfactory signaling pathways and overall sensory perception. As scientists delve deeper into the characterization of OR5D14, it is expected that this work will provide valuable knowledge applicable in areas such as neurobiology, pharmacology, and sensory science.
