Analytical Data
-
Gene name
OR5BF1
- Application
-
Alternative Names
OR14C36; OR5BF1; Olfactory receptor 14C36; Olfactory receptor 5BF1; Olfactory receptor OR1-59
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NHC7
-
Expression Region
1-312 aa
-
AA Sequence
MPNSTTVMEFLLMRFSDVWTLQILHSASFFMLYLVTLMGNILIVTVTTCDSSLHMPMYFF LRNLSILDACYISVTVPTSCVNSLLDSTTISKAGCVAQVFLVVFFVYVELLFLTIMAHDR YVAVCQPLHYPVIVNSRICIQMTLASLLSGLVYAGMHTGSTFQLPFCRSNVIHQFFCDIP SLLKLSCSDTFSNEVMIVVSALGVGGGCFIFIIRSYIHIFSTVLGFPRGADRTKAFSTCI PHILVVSVFLSSCSSVYLRPPAIPAATQDLILSGFYSIMPPLFNPIIYSLRNKQIKVAIK KIMKRIFYSENV
-
Molecular Weight
34.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR5BF1 is a member of the olfactory receptor gene family, specifically involved in the detection of certain volatile compounds, which play a critical role in our sense of smell. Research into OR5BF1 has gained significance due to its association with various physiological and psychological responses linked to olfactory perception. Advances in recombinant DNA technology have enabled the production of OR5BF1 as a recombinant protein, facilitating in-depth studies of its structure-function relationships and interaction with odorant molecules. Understanding OR5BF1's mechanisms can shed light on the olfactory system's complexities and its implications in neuronal signaling pathways. Additionally, dysregulation or mutations in olfactory receptors like OR5BF1 have been linked to conditions such as anosmia or altered sensory responses, highlighting the importance of this research in biomedical applications and potential therapeutic strategies. The exploration of OR5BF1 can pave the way for innovative approaches in flavor and fragrance industries, as well as contribute to the development of olfactory-based diagnostics and treatments. Overall, OR5BF1's recombinant protein research represents a promising frontier in sensory biology, with wide-ranging applications and implications for human health and disease.
