Analytical Data
-
Gene name
OR52W1
- Application
-
Alternative Names
OR52W1; OR52W1P; Olfactory receptor 52W1; Olfactory receptor OR11-71
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6IF63
-
Expression Region
1-320 aa
-
AA Sequence
MAETLQLNSTFLHPNFFILTGFPGLGSAQTWLTLVFGPIYLLALLGNGALPAVVWIDSTL HQPMFLLLAILAATDLGLATSIAPGLLAVLWLGPRSVPYAVCLVQMFFVHALTAMESGVL LAMACDRAAAIGRPLHYPVLVTKACVGYAALALALKAVAIVVPFPLLVAKFEHFQAKTIG HTYCAHMAVVELVVGNTQATNLYGLALSLAISGMDILGITGSYGLIAHAVLQLPTREAHA KAFGTCSSHICVILAFYIPGLFSYLTHRFGHHTVPKPVHILLSNIYLLLPPALNPLIYGA RTKQIRDRLLETFTFRKSPL
-
Molecular Weight
34.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR52W1 is a member of the olfactory receptor (OR) family, known for its role in the detection of volatile substances, contributing to the sense of smell. Research on OR52W1 has gained attention due to its potential implications in various physiological and pathological processes, including neurobiology and cancer biology. This receptor has been linked to the modulation of neuronal signaling pathways and may influence behaviors related to olfactory processing. Furthermore, studies have suggested that OR52W1 could be involved in the mechanisms of tumor progression and metastasis, as certain ORs have been implicated in cellular migration and invasion. The recombinant protein of OR52W1 provides a valuable tool for investigating its structural and functional characteristics, allowing researchers to elucidate its binding properties and signaling mechanisms in cells. Understanding the function of OR52W1 not only enriches our knowledge of olfactory receptors but also opens avenues for developing novel therapeutic strategies in treating diseases where olfactory signaling may play a role. By studying the recombinant protein and its interactions, researchers hope to uncover new insights into the complex network of olfactory signaling and its broader implications in health and disease.
