Analytical Data
-
Gene name
OR52E8
- Application
-
Alternative Names
OR52E8; Olfactory receptor 52E8; Olfactory receptor OR11-54
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6IFG1
-
Expression Region
1-317 aa
-
AA Sequence
MAGRMSTSNHTQFHPSSFLLLGIPGLEDVHIWIGVPFFFVYLVALLGNTALLFVIQTEQS LHEPMYYFLAMLDSIDLGLSTATIPKMLGIFWFNTKEISFGGCLSHMFFIHFFTAMESIV LVAMAFDRYIAICKPLRYTMILTSKIISLIAGIAVLRSLYMVVPLVFLLLRLPFCGHRII PHTYCEHMGIARLACASIKVNIRFGLGNISLLLLDVILIILSYVRILYAVFCLPSWEARL KALNTCGSHIGVILAFFTPAFFSFLTHRFGHNIPQYIHIILANLYVVVPPALNPVIYGVR TKQIRERVLRIFLKTNH
-
Molecular Weight
35.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR52E8 is a member of the olfactory receptor family, which plays a crucial role in the detection of odorants and olfactory signaling. Recent studies have indicated that this receptor, although primarily associated with the sense of smell, may also have implications in non-olfactory processes, including respiratory physiology and potential roles in modulating neural pathways. The interest in OR52E8 has grown due to its unique expression patterns and the potential involvement in various biological functions, including respiratory diseases and neurodegenerative conditions. Researchers aim to investigate the structural and functional properties of OR52E8 through recombinant protein expression, enabling detailed studies on its role in olfactory transduction and other physiological processes. By using advanced techniques in molecular biology and biochemistry, scientists seek to elucidate its signaling mechanisms and interactions with ligands, ultimately contributing to a better understanding of sensory biology and potential therapeutic applications. This research could open new avenues for drug discovery and the development of novel interventions targeting olfactory-related disorders and beyond.
