Analytical Data
-
Gene name
TACSTD2
- Application
-
Alternative Names
TACSTD2;GA733-1;Tumor-associated calcium signal transducer 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09758
-
Expression Region
27-323aa
-
AA Sequence
HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLL KARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCW CVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAEL RRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYF ERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAG LIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
-
Molecular Weight
59 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TACSTD2, also known as tumor-associated calcium signal transducer 2, is a member of the tetraspanin family and plays a significant role in cellular signaling, adhesion, and proliferation. Its expression is notably elevated in various tumors, indicating its potential as a biomarker for cancer diagnosis and prognosis. Research into TACSTD2 recombinant proteins has gained momentum due to the increasing interest in targeted therapies and immunotherapy strategies. The study of TACSTD2 is particularly relevant in the context of tumors, such as colorectal cancer, where it has been implicated in cancer cell growth and metastasis. Understanding TACSTD2's function and interactions at the molecular level could provide insights into tumor microenvironments and the mechanisms of cancer progression. Furthermore, recombinant TACSTD2 proteins are being explored for their use in developing vaccines that stimulate immune responses against cancer cells expressing TACSTD2, thereby paving the way for novel therapeutic approaches. This area of research not only enhances our understanding of tumor biology but also holds promise for advancing clinical applications in cancer treatment.











