Analytical Data
-
Gene name
INSIG1
- Application
-
Alternative Names
INSIG1；Insulin-induced gene 1 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15503
-
Expression Region
1-277aa
-
AA Sequence
MPRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLLQRSLVLFSVGVVLALVLNLLQIQRNVTLFPEEVIATIFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD
-
Molecular Weight
29.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
INSIG1 (Insulin-Induced Gene 1) is a critical protein involved in the regulation of cholesterol and fatty acid metabolism. It plays a significant role in maintaining cellular lipid homeostasis by acting as a key regulator in the SREBP (sterol regulatory element-binding protein) pathway. INSIG1 binds to SREBP, preventing its activation and subsequent transcription of lipogenic genes when intracellular cholesterol levels are adequate. The dysregulation of INSIG1 has been implicated in various metabolic disorders, including obesity, diabetes, and cardiovascular diseases. The interest in recombinant INSIG1 protein research arises from its potential as a therapeutic target for these conditions. By producing this protein through recombinant DNA technology, researchers aim to better understand its functional mechanisms, interactions, and the consequences of its modulation in lipid metabolism. Furthermore, studying INSIG1 could lead to the development of novel interventions for managing metabolic diseases linked to lipid imbalances. Overall, the exploration of INSIG1 as a recombinant protein not only enhances fundamental biological insights but also paves the way for innovative approaches in treating metabolic disorders, highlighting its importance in both basic and applied biomedical research.
