Analytical Data
-
Gene name
ALX3
- Application
-
Alternative Names
ALX3Homeobox Protein aristaless-like 3; Proline-rich transcription factor ALX3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95076
-
Expression Region
1-343aa
-
AA Sequence
MDPEHCAPFRVGPAPGPYVASGDEPPGPQGTPAAAPHLHPAPPRGPRLTRFPACGPLEPYLPEPAKPPAKYLQDLGPGPALNGGHFYEGPAEAEEKTSKAASFPQLPLDCRGGPRDGPSNLQGSPGPCLASLHLPLSPGLPDSMELAKNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTAAYDISVLPRTDSHPQLQNSLWASPGSGSPGGPCLVSPEGIPSPCMSPYSHPHGSVAGFMGVPAPSAAHPGIYSIHGFPPTLGGHSFEPSSDGDYKSPSLVSLRVKPKEPPGLLNWTT
-
Molecular Weight
36.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ALX3, a member of the ALX (Aly-class homeobox) gene family, plays a crucial role in embryonic development and tissue patterning. It is involved in regulatory processes that govern organogenesis and cell differentiation, particularly in the development of the pancreas, intestine, and other organs. Research into the ALX3 recombinant protein has gained interest due to its potential implications in understanding congenital malformations and diseases associated with ALX3 dysfunction, including certain types of cancer and developmental disorders. By investigating the structure and functional properties of ALX3, scientists aim to elucidate the molecular mechanisms underlying its role in development. The recombinant form of ALX3 can be produced using various expression systems, allowing for in-depth functional assays, protein-protein interaction studies, and high-throughput screening of small molecule inhibitors or modulators. These studies are vital for developing therapeutic approaches that could potentially target ALX3-related pathways, offering avenues for intervention in diseases where ALX3 is implicated. The growing body of knowledge surrounding the ALX3 protein not only enhances our understanding of its biological significance but also helps identify its potential as a biomarker for certain conditions, paving the way for innovative treatments in regenerative medicine and oncology.
