Analytical Data
-
Gene name
OR52E6
- Application
-
Alternative Names
OR52E6; Olfactory receptor 52E6; Olfactory receptor OR11-58
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96RD3
-
Expression Region
1-313 aa
-
AA Sequence
MPIANDTQFHTSSFLLLGIPGLEDVHIWIGFPFFSVYLIALLGNAAIFFVIQTEQSLHEP MYYCLAMLDSIDLSLSTATIPKMLGIFWFNIKEISFGGYLSQMFFIHFFTVMESIVLVAM AFDRYIAICKPLWYTMILTSKIISLIAGIAVLRSLYMVIPLVFLLLRLPFCGHRIIPHTY CEHMGIARLACASIKVNIMFGLGSISLLLLDVLLIILSHIRILYAVFCLPSWEARLKALN TCGSHIGVILAFSTPAFFSFFTHCFGHDIPQYIHIFLANLYVVVPPTLNPVIYGVRTKHI RETVLRIFFKTDH
-
Molecular Weight
35.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR52E6 protein, a member of the olfactory receptor family, has garnered substantial interest in recent years due to its potential role in sensory biology and human health. Olfactory receptors are G protein-coupled receptors (GPCRs) that participate in the detection of odorant molecules, playing a crucial role in the sense of smell. However, the function of many olfactory receptors, including OR52E6, remains largely unexplored. Research has indicated that these receptors may be involved not only in olfactory signaling but also in various physiological and pathological processes, including neurodegenerative diseases and cancer. The study of OR52E6, particularly through recombinant expression, allows for detailed investigation of its structure, ligand specificity, and signaling mechanisms. This research could pave the way for new therapeutic approaches targeting olfactory receptors and elucidate their roles beyond traditional sensory functions. Moreover, the ability to express OR52E6 as a recombinant protein opens opportunities for high-throughput screening and characterization of potential ligands, ultimately contributing to a deeper understanding of olfactory receptor biology and its implications for health and disease.
