Analytical Data
-
Gene name
OR51I1
- Application
-
Alternative Names
OR51I1; Olfactory receptor 51I1; Odorant receptor HOR5'beta11; Olfactory receptor OR11-39
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H343
-
Expression Region
1-314 aa
-
AA Sequence
MLGLNGTPFQPATLQLTGIPGIQTGLTWVALIFCILYMISIVGNLSILTLVFWEPALHQP MYYFLSMLALNDLGVSFSTLPTVISTFCFNYNHVAFNACLVQMFFIHTFSFMESGILLAM SLDRFVAICYPLRYVTVLTHNRILAMGLGILTKSFTTLFPFPFVVKRLPFCKGNVLHHSY CLHPDLMKVACGDIHVNNIYGLLVIIFTYGMDSTFILLSYALILRAMLVIISQEQRLKAL NTCMSHICAVLAFYVPIIAVSMIHRFWKSAPPVVHVMMSNVYLFVPPMLNPIIYSVKTKE IRKGILKFFHKSQA
-
Molecular Weight
35.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR51I1, also known as Olfactory Receptor 51I1, is a member of the extensive family of G protein-coupled receptors (GPCRs) that play critical roles in the sensory perception of odors. Research into OR51I1 has gained interest due to its unique expression patterns and potential involvement in various physiological processes beyond olfaction, including cancer progression and inflammatory responses. Recent studies suggest that OR51I1 may be activated by certain non-volatile compounds, offering new insights into its functions and signaling mechanisms. This has led to investigations aimed at understanding its ligand specificity, structural characteristics, and potential therapeutic applications. Given its emerging role in mediating several biological responses, characterizing the recombinant protein of OR51I1 offers a valuable opportunity to delve deeper into its functions, interactions, and significance in health and disease. Thus, the research surrounding OR51I1 recombinant protein is pivotal for unraveling the complexities of GPCR signaling and exploring novel avenues for drug development, particularly in targeting pathways involved in disease modulation.
