Analytical Data
-
Gene name
OR51G2
- Application
-
Alternative Names
OR51G2; Olfactory receptor 51G2; Olfactory receptor OR11-28
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGK0
-
Expression Region
1-314 aa
-
AA Sequence
MTLGSLGNSSSSVSATFLLSGIPGLERMHIWISIPLCFMYLVSIPGNCTILFIIKTERSL HEPMYLFLSMLALIDLGLSLCTLPTVLGIFWVGAREISHDACFAQLFFIHCFSFLESSVL LSMAFDRFVAICHPLHYVSILTNTVIGRIGLVSLGRSVALIFPLPFMLKRFPYCGSPVLS HSYCLHQEVMKLACADMKANSIYGMFVIVSTVGIDSLLILFSYALILRTVLSIASRAERF KALNTCVSHICAVLLFYTPMIGLSVIHRFGKQAPHLVQVVMGFMYLLFPPVMNPIVYSVK TKQIRDRVTHAFCY
-
Molecular Weight
35.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR51G2 is a member of the olfactory receptor (OR) gene family, primarily recognized for its involvement in the human sense of smell. Recent studies have suggested that OR51G2 may have roles beyond olfaction, including potential implications in various physiological and pathological processes. Given its expression in non-olfactory tissues such as the prostate, research has focused on its involvement in tumor biology and potential links to prostate cancer. The ability to produce recombinant OR51G2 protein is crucial for advancing our understanding of its structure, function, and potential therapeutic applications. By generating this protein in a laboratory setting, researchers can conduct detailed functional assays, analyze binding interactions with potential ligands, and explore the receptor's signaling pathways. Further investigation of OR51G2 may uncover significant insights into its role in human health and disease, leading to novel diagnostic or therapeutic strategies. Overall, the study of OR51G2 recombinant protein is a promising area of research that could bridge the gap between olfactory biology and broader medical applications.
