Analytical Data
-
Gene name
VAMP1
- Application
-
Alternative Names
VAMP1；SYB1；Vesicle-associated membrane Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23763
-
Expression Region
1-118aa
-
AA Sequence
MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VAMP1 (Vesicle-Associated Membrane Protein 1) is a critical protein involved in the process of synaptic vesicle exocytosis, playing a vital role in neurotransmitter release at synapses. As part of the SNARE (Soluble NSF Attachment Protein Receptor) complex, VAMP1 interacts with other proteins to facilitate the fusion of vesicles with the plasma membrane, a fundamental step in neuronal communication. Research into VAMP1 recombinant protein has gained momentum due to its significance in understanding neurobiology and potential implications in neurodegenerative diseases and synaptic dysfunctions. Mutations or dysregulation of VAMP1 have been linked to various neurological disorders, making it a target for therapeutic intervention. Recombinant VAMP1 can be produced in various expression systems, allowing for detailed biochemical and structural studies to elucidate its role in synaptic transmission. This research not only provides insights into the mechanisms underlying neuronal signaling but also lays the groundwork for developing drugs that may restore or enhance synaptic function in pathological conditions. Thus, studying VAMP1 and its recombinant protein form is critical for advancing our understanding of synaptic biology and developing interventions for neurological diseases.
