Analytical Data
-
Gene name
OR51E2
- Application
-
Alternative Names
OR51E2; PSGR; Olfactory receptor 51E2; HPRAJ; Olfactory receptor OR11-16; Prostate-specific G-protein coupled receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H255
-
Expression Region
1-320 aa
-
AA Sequence
MSSCNFTHATFVLIGIPGLEKAHFWVGFPLLSMYVVAMFGNCIVVFIVRTERSLHAPMYL FLCMLAAIDLALSTSTMPKILALFWFDSREISFEACLTQMFFIHALSAIESTILLAMAFD RYVAICHPLRHAAVLNNTVTAQIGIVAVVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVH QDVMKLAYADTLPNVVYGLTAILLVMGVDVMFISLSYFLIIRTVLQLPSKSERAKAFGTC VSHIGVVLAFYVPLIGLSVVHRFGNSLHPIVRVVMGDIYLLLPPVINPIIYGAKTKQIRT RVLAMFKISCDKDLQAVGGK
-
Molecular Weight
35.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR51E2, a member of the olfactory receptor (OR) gene family, has gained significant attention in recent years due to its unique expression patterns and potential roles beyond traditional olfactory functions. Originally characterized for its involvement in the detection of volatile compounds, OR51E2 has been implicated in various physiological processes, including implications in cancer biology and neural signaling. Research has demonstrated that OR51E2 is expressed not only in the olfactory system but also in other tissues, suggesting that it may serve non-canonical roles in modulation of cell signaling pathways. This has prompted investigations into its potential mechanisms of action, particularly its interactions with other cellular receptors and signaling molecules. Understanding the structural and functional characteristics of OR51E2 through recombinant protein studies can provide insights into its ligand specificity and downstream effects. Furthermore, the exploration of OR51E2's involvement in disease mechanisms could open new avenues for therapeutic strategies targeting this receptor in conditions such as cancer or neurological disorders. Overall, the study of OR51E2 as a recombinant protein offers a promising avenue in elucidating the complexities of receptor signaling and its implications in health and disease.
