Analytical Data
-
Gene name
OR51F2
- Application
-
Alternative Names
OR51F2; Olfactory receptor 51F2; Olfactory receptor OR11-23
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NH61
-
Expression Region
1-342 aa
-
AA Sequence
MTETSLSSQCFPMSVLNNTIAEPLIFLLMGIPGLKATQYWISIPFCLLYVVAVSGNSMIL FVVLCERSLHKPMYYFLSMLSATDLSLSLCTLSTTLGVFWFEAREINLNACIAQMFFLHG FTFMESGVLLAMAFDRFVAICYPLRYTTILTNARIAKIGMSMLIRNVAVMLPVMLFVKRL SFCSSMVLSHSYCYHVDLIQLSCTDNRINSILGLFALLSTTGFDCPCILLSYILIIRSVL SIASSEERRKAFNTCTSHISAVSIFYLPLISLSLVHRYGHSAPPFVHIIMANVFLLIPPV LNPIIYSVKIKQIQKAIIKVLIQKHSKSNHQLFLIRDKAIYE
-
Molecular Weight
38.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR51F2 (Olfactory Receptor Family 51 Subfamily F Member 2) is a member of the olfactory receptor gene family, which plays a crucial role in the detection of volatile substances in the environment. Recent studies have uncovered its potential involvement not only in olfaction but also in various physiological processes, including tumor progression and immune response modulation. Given its unique expression patterns and functional implications, OR51F2 has emerged as a target of interest in cancer research, particularly in the context of prostate and breast cancers, where it may influence tumor microenvironments and patient outcomes. The study of recombinant OR51F2 protein provides significant insights into its structural and functional characteristics, enabling researchers to explore its binding affinities with various ligands and its signaling pathways. Understanding these mechanisms could unveil new therapeutic strategies aimed at targeting OR51F2 for the treatment of diseases, particularly cancers where it is aberrantly expressed. Furthermore, the analysis of OR51F2's role in non-canonical pathways opens new avenues for research on how olfactory receptors contribute to processes beyond traditional senses, thus expanding the functional horizon of this receptor family in health and disease.
