Cat: PA1000-3093

Recombinant Human SUOX Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SUOX

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SUOX;Sulfite oxidase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P51687

  • Expression Region

    80-545aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSESTHIYTKEEVSSHTSPETGIWVTLGS EVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVHNQSHVRELLAQYK IGELNPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTEN YITPNPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRY EITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAG HQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQP LPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPS VDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRA VIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNI VCKAVDDGYNVQPDTVAPIWNLRGVLSNAW HRVHVYVSP

  • Molecular Weight

    54 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SUOX (sulfite oxidase) is a crucial enzyme in the human body that plays a significant role in the metabolism of sulfur-containing amino acids, specifically in the conversion of sulfite to sulfate, a process vital for the detoxification of sulfite. Deficiencies in SUOX can lead to sulfite accumulation, resulting in severe neurological disorders and other health issues. Research into SUOX has gained momentum due to the potential therapeutic implications for treating sulfite-related diseases, including sulfite oxidase deficiency, characterized by developmental delays and other neurological symptoms. Recombinant SUOX protein has been explored as a promising avenue for enzyme replacement therapy or as a tool for investigating the biochemical pathways involving sulfur metabolism. The production and characterization of recombinant SUOX allow researchers to study its kinetic properties, structure-function relationships, and interactions with various substrates and inhibitors. Enhanced understanding of SUOX functionality could pave the way for novel treatment strategies and contribute to our knowledge of related metabolic disorders, emphasizing the relevance of SUOX research in the fields of biochemistry and medicine. Furthermore, advancements in gene editing technologies and synthetic biology may further facilitate the development of SUOX-based therapies, potentially offering new hope for individuals affected by sulfite intolerances and related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US