Analytical Data
-
Gene name
OR2L13
- Application
-
Alternative Names
OR2L13; OR2L14; Olfactory receptor 2L13; Olfactory receptor 2L14
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N349
-
Expression Region
1-312 aa
-
AA Sequence
MEKWNHTSNDFILLGLLPPNQTGIFLLCLIILIFFLASVGNSAMIHLIHVDPRLHTPMYF LLSQLSLMDLMYISTTVPKMAYNFLSGQKGISFLGCGVQSFFFLTMACSEGLLLTSMAYD RYLAICHSLYYPIRMSKMMCVKMIGGSWTLGSINSLAHTVFALHIPYCRSRAIDHFFCDV PAMLLLACTDTWVYEYMVFVSTSLFLLFPFIGITSSCGRVLFAVYHMHSKEGRKKAFTTI STHLTVVIFYYAPFVYTYLRPRNLRSPAEDKILAVFYTILTPMLNPIIYSLRNKEVLGAM RRVFGIFSFLKE
-
Molecular Weight
35.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2L13, a member of the olfactory receptor family, has garnered significant interest in recent years due to its potential role in odor perception and related neurological processes. Olfactory receptors are G-protein-coupled receptors located primarily in the nasal epithelium and are crucial for the sense of smell. Although there are approximately 400 functional olfactory receptors in humans, many are still not well-characterized in terms of their specific ligands and biological significance. Research into OR2L13 has revealed its involvement in detecting specific volatile compounds, which may suggest its role in food preference, environmental awareness, and even social interactions. Additionally, there is emerging evidence that significant variations in olfactory receptor genes, including OR2L13, can be linked to differences in olfactory sensitivity among individuals, further emphasizing its importance in the sensory experience. The characterization and expression of OR2L13 as a recombinant protein can facilitate a deeper understanding of its binding properties and functional mechanisms, contributing to the broader field of olfactory biology and potential therapeutic applications in addressing olfactory dysfunction. Overall, OR2L13 represents a fascinating area of study within the olfactory receptor landscape, with implications extending beyond basic sensory perception to a variety of behavioral and physiological responses.
