Analytical Data
-
Gene name
STAR
- Application
-
Alternative Names
STAR；STARD1；Steroidogenic acute regulatory Protein. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49675
-
Expression Region
64-285aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMEETLYSDQELAYLQQGEEAMQKALGILSN QEGWKKESQQDNGDKVMSKVVPDVGKVFRLEVVVDQPMERLYEELVERME AMGEWNPNVKEIKVLQKIGKDTFITHELAAEAAGNLVGPRDFVSVRCAKR RGSTCVLAGMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWL LSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPASEARC
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The STAR (signal transduction and activation of RNA) proteins play a pivotal role in the regulation of gene expression and alternative splicing. Characterized by their RNA-binding capabilities, these proteins are essential in various cellular processes, including mRNA processing, transport, and translation. Dysregulation of STAR proteins has been implicated in numerous diseases, particularly cancer and neurodegenerative disorders, highlighting their significance in maintaining cellular homeostasis. Research into STAR proteins has increased due to their potential as therapeutic targets, as manipulating their activity could lead to novel treatments for these conditions. Additionally, studying STAR proteins provides insights into the intricate mechanisms of post-transcriptional regulation, contributing to our understanding of how cells respond to environmental cues and stressors. As such, the ongoing exploration of STAR proteins is crucial for advancing the fields of molecular biology and biomedicine, offering hope for innovative strategies to combat complex diseases.
