Cat: PA2000-5402

Recombinant Human AGTPBP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AGTPBP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CCP1; 1700020N17Rik; 2310001G17Rik; 2900054O13Rik; 4930445M19Rik; 5730402G09Rik

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UPW5

  • Expression Region

    1087-1186aa

  • AA Sequence

    GAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSELSRTYLP

  • Molecular Weight

    36.74 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AGTPBP1, a member of the GTPase superfamily, has garnered significant attention in recent years due to its pivotal role in cellular processes and potential implications in disease mechanisms. Initially identified through comparative genomic studies, AGTPBP1 is involved in various biological functions, including mitochondrial dynamics, RNA processing, and cellular stress responses. Research has shown that mutations or dysregulation of AGTPBP1 can lead to pathological conditions, particularly in neurodegenerative diseases, highlighting its importance in maintaining cellular homeostasis. The recombinant expression of AGTPBP1 allows for the detailed examination of its structural and functional properties, facilitating the understanding of its molecular mechanisms. By producing AGTPBP1 in a controlled environment, researchers are able to investigate its interactions with other proteins and nucleic acids, paving the way for potential therapeutic interventions. Moreover, the study of AGTPBP1 in recombinant systems may elucidate its regulatory pathways and interactions, providing insights into its biological significance and therapeutic potential. The ongoing research into AGTPBP1 not only enhances our understanding of basic cellular biology but also opens up new avenues for developing novel treatments targeting its dysfunction in various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US