Analytical Data
-
Gene name
AGTPBP1
- Application
-
Alternative Names
CCP1; 1700020N17Rik; 2310001G17Rik; 2900054O13Rik; 4930445M19Rik; 5730402G09Rik
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UPW5
-
Expression Region
1087-1186aa
-
AA Sequence
GAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSELSRTYLP
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AGTPBP1, a member of the GTPase superfamily, has garnered significant attention in recent years due to its pivotal role in cellular processes and potential implications in disease mechanisms. Initially identified through comparative genomic studies, AGTPBP1 is involved in various biological functions, including mitochondrial dynamics, RNA processing, and cellular stress responses. Research has shown that mutations or dysregulation of AGTPBP1 can lead to pathological conditions, particularly in neurodegenerative diseases, highlighting its importance in maintaining cellular homeostasis. The recombinant expression of AGTPBP1 allows for the detailed examination of its structural and functional properties, facilitating the understanding of its molecular mechanisms. By producing AGTPBP1 in a controlled environment, researchers are able to investigate its interactions with other proteins and nucleic acids, paving the way for potential therapeutic interventions. Moreover, the study of AGTPBP1 in recombinant systems may elucidate its regulatory pathways and interactions, providing insights into its biological significance and therapeutic potential. The ongoing research into AGTPBP1 not only enhances our understanding of basic cellular biology but also opens up new avenues for developing novel treatments targeting its dysfunction in various diseases.
