Analytical Data
-
Gene name
OR2J2
- Application
-
Alternative Names
OR2J2; Olfactory receptor 2J2; Hs6M1-6; Olfactory receptor 6-8; OR6-8; Olfactory receptor OR6-19
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O76002
-
Expression Region
1-312 aa
-
AA Sequence
MMIKKNASSEDFFILLGFSNWPQLEVVLFVVILIFYLMTLTGNLFIIILSYVDSHLHTPM YFFLSNLSFLDLCHTTSSIPQLLVNLRGPEKTISYAGCMVQLYFVLALGIAECVLLVVMS YDRYVAVCRPLHYTVLMHPRFCHLLAAASWVIGFTISALHSSFTFWVPLCGHRLVDHFFC EVPALLRLSCVDTHANELTLMVMSSIFVLIPLILILTAYGAIARAVLSMQSTTGLQKVFR TCGAHLMVVSLFFIPVMCMYLQPPSENSPDQGKFIALFYTVVTPSLNPLIYTLRNKHVKG AAKRLLGWEWGK
-
Molecular Weight
35.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2J2 is a member of the olfactory receptor gene family, predominantly expressed in the olfactory epithelium, where it plays a critical role in the sensory perception of odorants. Recent research has highlighted the importance of olfactory receptors beyond the traditional realm of smell, suggesting their involvement in various physiological processes, including immune response and neurobiology. The interest in OR2J2 has surged due to its potential implications in diverse fields such as pharmacology, neurology, and even cancer biology. Studies indicate that OR2J2 may be activated by specific ligands, which can modulate signaling pathways that influence cellular behavior. To fully understand its functional relevance, researchers have turned to recombinant protein techniques to express and purify OR2J2, enabling detailed studies of its structure, ligand-binding capabilities, and downstream signaling mechanisms. This protein research can pave the way for novel therapeutic strategies, including the development of drugs targeting OR2J2's signaling pathways, ultimately contributing to advancements in treating disorders linked to olfactory dysfunction and other associated diseases.
