Analytical Data
-
Gene name
OR2J1
- Application
-
Alternative Names
OR2J1; OR2J1P; Olfactory receptor 2J1; Hs6M1-4; Olfactory receptor 6-5; OR6-5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9GZK6
-
Expression Region
1-312 aa
-
AA Sequence
MLMKKNASFEDFFLLLGFSNWPHLEVVLFVVILIFYLITLIGNLFIIILSYLDSHLHTPM YFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCTVQLYFVLALGTAECVLLVVMS YDRYAAVCRPLHYTVLMHPRFCRLLAAASWVSGFTTSALHSSFTFWIPLCRHRLVDHFFC EVPALLRLSCVDTQANELTLMVMSSIFVLIPLILILTSYGAIARAVLSMQSTTGLQKVLR TCGAHLMVVSLFFIPVMCMYLQPPSENSQDQGKFIALFYTVVTPSLNPLIYTFRNKDVRG AVKRLMGWEWGM
-
Molecular Weight
35.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2J1, a member of the olfactory receptor family, has gained attention due to its potential role in various physiological processes and implications in neurological and psychiatric disorders. As an odorant receptor, OR2J1 is primarily associated with the detection of certain volatile compounds, but emerging studies suggest that it may also be involved in non-olfactory functions. Research indicates that OR2J1 might influence neuronal signaling pathways and could be implicated in the modulation of mood and behavior. The receptor is expressed in both olfactory and non-olfactory tissues, suggesting a broader biological significance. Advances in molecular biology techniques, including the development of recombinant OR2J1 proteins, have facilitated the investigation of its ligand binding characteristics, signaling mechanisms, and functional roles. Understanding OR2J1's structure and function may provide insights into its involvement in health and disease, potentially leading to novel therapeutic targets for neuropsychiatric conditions. The ongoing exploration of OR2J1 could not only illuminate the complexities of sensory perception but also enhance our comprehension of its contributions to cognitive and emotional regulation.











