Cat: PA1000-3035

Recombinant Human STAMBP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    STAMBP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    STAMBP;AMSH;STAM-binding Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95630

  • Expression Region

    1-424aa

  • AA Sequence

    MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIY SEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAF PKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVA QQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDL EKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPT IDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVL IPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLH THCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSK DPPLFCSCSHVTVVDRAVTITDLR

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

STAMBP (Signal Transducing Adaptor Molecule Binding Protein) is a crucial player in various cellular processes, particularly in signal transduction and protein degradation pathways. Recent studies have highlighted its role in the endosomal sorting complex required for transport (ESCRT) pathway, which is essential for the downregulation of receptor signaling and the maintenance of cellular homeostasis. The interest in STAMBP has surged due to its implications in cancer biology, where its altered expression and function can affect tumor progression and response to therapy. Additionally, STAMBP's involvement in neurodegenerative diseases has sparked research aimed at understanding its potential as a therapeutic target. The recombinant expression of STAMBP provides a valuable tool for dissecting its biochemical properties, elucidating its molecular interactions, and exploring its functional roles in various signaling pathways. Researchers are developing assays to study STAMBP's ubiquitin-binding capacity and its influence on protein turnover, which may reveal new insights into the regulatory mechanisms that govern cellular signaling and contribute to disease states. As a result, the study of STAMBP and its recombinant forms promises to enhance our understanding of fundamental biological processes and to inform the development of novel therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US