Analytical Data
-
Gene name
SPRR3
- Application
-
Alternative Names
SPRR3；SPRC；Small proline-rich Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBC9
-
Expression Region
2-169aa
-
AA Sequence
SSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK
-
Molecular Weight
34.0kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPRR3 (Small Proline-Rich Protein 3) is a member of the small proline-rich protein family, which plays a crucial role in various biological processes, including skin barrier function, wound healing, and immune response. The expression of SPRR3 is often upregulated in response to epidermal injury and stress, indicating its potential role in tissue repair and regeneration. Recent studies have suggested that SPRR3 may also be involved in the pathogenesis of certain diseases, including cancer, where its dysregulation could influence tumor growth and metastasis. The investigation of SPRR3 as a recombinant protein has garnered interest due to its potential applications in therapeutic strategies and biomarker development. By producing recombinant SPRR3, researchers aim to decipher its biochemical properties, understand its interactions with other proteins, and evaluate its functional roles in cellular processes. This research could illuminate the mechanisms underlying skin-related disorders and pave the way for novel treatment approaches. Furthermore, recombinant SPRR3 could serve as a valuable tool in studying the molecular pathways associated with proline-rich proteins and their influence on cellular behavior, thereby contributing to the broader understanding of protein function in health and disease.
