Analytical Data
-
Gene name
PFAS
- Application
-
Alternative Names
PFAS;KIAA0361;Phosphoribosylformylglycinamidine synthase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15067
-
Expression Region
1064-1302aa
-
AA Sequence
RVAILREEGSNGDREMADAFHLAGFEVWDVTMQDLCSGAIGLDTFRGVAF VGGFSYADVLGSAKGWAAAVTFHPRAGAELRRFRKRPDTFSLGVCNGCQL LALLGWVGGDPNEDAAEMGPDSQPARPGLLLRHNLSGRYESRWASVRVGP GPALMLRGMEGAVLPVWSAHGEGYVAFSSPELQAQIEARGLAPLHWADDD GNPTEQYPLNPNGSPGGVAGICSCDGRHLAVMPHPERAV
-
Molecular Weight
45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PFAS (per- and polyfluoroalkyl substances) are a class of synthetic chemicals known for their persistence in the environment and human body, leading to a growing concern regarding their health and ecological impacts. These substances have been widely used in applications such as firefighting foams, waterproof clothing, and food packaging due to their water- and oil-repellent properties. Despite their utility, PFAS are often referred to as "forever chemicals" because they do not break down easily, resulting in accumulation in soil, groundwater, and living organisms. Recent studies have linked PFAS exposure to various adverse health effects, including cancers, liver damage, immunotoxicity, and developmental issues. The complex nature of PFAS, with their myriad different compounds and varying toxicological profiles, has necessitated innovative research methods to better understand their mechanisms of action and biological interactions. One promising approach involves the development of recombinant proteins that can mimic the binding properties of these substances, allowing researchers to investigate how PFAS interact at a molecular level. By using techniques such as protein engineering and expressed recombinance, scientists aim to create specific binding proteins that can serve as biosensors or bioremediation tools to detect and mitigate the effects of PFAS in the environment. This line of research not only addresses the pressing need for effective PFAS detection and remediation strategies but also contributes to the broader understanding of how these persistent chemicals impact human health and the ecosystem. Through the advancement of recombinant protein technologies, the scientific community hopes to pave the way for innovative solutions to tackle the PFAS contamination crisis.











