Analytical Data
-
Gene name
ACCN4
- Application
-
Alternative Names
ACCN4；ACCN4；Acid-sensing ion channel 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96FT7
-
Expression Region
1-539aa
-
AA Sequence
MPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLATFASTSTLHGLGRACGPGPHGLRRTLWALALLTSLAAFLYQAAGLARGYLTRPHLVAMDPAAPAPVAGFPAVTLCNINRFRHSALSDADIFHLANLTGLPPKDRDGHRAAGLRYPEPDMVDILNRTGHQLADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPRSSLPSRAGGMGSGLEIMLDIQQEEYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRAESELREPELQGYSAYSVSACRLRCEKEAVLQRCHCRMVHMPGNETICPPNIYIECADHTLDSLGGGPEGPCFCPTPCNLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIGASILTLLEILDYIYEVSWDRLKRVWRRPKTPLRTSTGGISTLGLQELKEQSPCPSRGRVEGGGVSSLLPNHHHPHGPPGGLFEDFAC
-
Molecular Weight
59.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACCN4, also known as the acid-sensing ion channel 4, is a member of the degenerin/epithelial sodium channel (DEG/ENaC) family, which plays a crucial role in sensing extracellular pH changes and modulating ion transport across cell membranes. Research surrounding ACCN4 has gained significant attention due to its involvement in various physiological processes and pathological conditions, including pain perception, inflammation, and potentially in the pathophysiology of certain neurological disorders. The reconstitution of ACCN4 as a recombinant protein allows for detailed structural and functional studies, facilitating the understanding of its role in cellular signaling and ion homeostasis. Utilizing advanced techniques such as electrophysiology and crystallography, researchers aim to elucidate the molecular mechanisms underpinning ACCN4 function, its interaction with ligands, and its regulatory pathways. Additionally, the development of specific inhibitors or modulators for ACCN4 presents promising therapeutic avenues for treating diseases linked to dysregulated ion channel activity. Overall, the study of ACCN4 recombinant protein is pivotal not only for enhancing our comprehension of ion channel biology but also for identifying novel targets for drug development in the realm of neurological and inflammatory disorders.
