Analytical Data
-
Gene name
OR2AG1
- Application
-
Alternative Names
OR2AG1; OR2AG3; Olfactory receptor 2AG1; HT3; Olfactory receptor 2AG3; Olfactory receptor OR11-79
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H205
-
Expression Region
1-316 aa
-
AA Sequence
MELWNFTLGSGFILVGILNDSGSPELLCATITILYLLALISNGLLLLAITMEARLHMPMY LLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAEDLLLAFMAY DRYVAICHPLTYMTLMSSRACWLMVATSWILASLSALIYTVYTMHYPFCRAQEIRHLLCE IPHLLKVACADTSRYELMVYVMGVTFLIPSLAAILASYTQILLTVLHMPSNEGRKKALVT CSSHLTVVGMFYGAATFMYVLPSSFHSTRQDNIISVFYTIVTPALNPLIYSLRNKEVMRA LRRVLGKYMLPAHSTL
-
Molecular Weight
35.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2AG1 is a member of the olfactory receptor family, which plays a crucial role in the perception of smell. These receptors are traditionally known for their function in the olfactory system, but recent studies suggest they may have additional roles in various biological processes beyond olfaction. The research surrounding OR2AG1 has garnered interest due to its unique expression patterns and potential implications in diseases, immune responses, and cell signaling pathways. Understanding the structure, function, and signaling mechanisms of OR2AG1 can provide insights into its physiological roles and how it may interact with various ligands or environmental factors. Furthermore, the recombination and expression of OR2AG1 as a recombinant protein can facilitate detailed studies on its biochemical properties and functional assays, paving the way for therapeutic applications. The exploration of OR2AG1 may reveal novel insights into receptor biology and its implications in health and disease, making it a compelling target for further scientific investigation.
