Analytical Data
-
Gene name
SSBP1
- Application
-
Alternative Names
SSBP1;SSBP;Single-stranded DNA-binding Protein. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q04837
-
Expression Region
17-148aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSESETTTSLVLERSLNRVHLLGRVGQDP VLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPG LRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQ TKEKE
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SSBP1 (Single-Stranded DNA Binding Protein 1) plays a critical role in cellular processes related to DNA replication, repair, and mitochondrial DNA maintenance. Research into SSBP1 has gained momentum due to its implications in various diseases, including neurodegenerative disorders and cancers. As a single-stranded DNA-binding protein, SSBP1 is essential for protecting newly synthesized DNA strands from degradation and preventing the formation of secondary structures that can hinder replication and transcription. Moreover, its involvement in mitochondrial function highlights its potential impact on metabolic diseases and genomic stability. The study of SSBP1 is further fueled by its interactions with other proteins and its regulatory roles, which could reveal novel therapeutic targets. Understanding the structural and functional dynamics of SSBP1 through recombinant protein expression and characterization may provide insights into its mechanisms and the downstream consequences of its dysregulation. This research is vital for developing interventions that could modulate SSBP1 activity, offering avenues for enhancing genomic integrity and addressing associated pathologies.
