Cat: PA2000-1294

Recombinant Human ETV5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ETV5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ETV5;ERM;ETS translocation variant 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P41161

  • Expression Region

    1-510aa

  • AA Sequence

    MASMTGGQQMGRGHHHHHHENLYFQGGEFDGFYDQQVPFMVPGKSRSEEC RGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAEAQVPDDEQFVPD FQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNYCA YDRKPPSGFKPLTPPTTPLSPTHQNPLFPPPQATLPTSGHAPAAGPVQGV GPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQL SEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYE HGVPGMPGPPAHGFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSH EGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGPPYQRRGSLQLWQ FLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKL SRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESE CHLSEEDTLPLTHFEDSPAYLLDMDRCSSLPYAEGFAY

  • Molecular Weight

    61 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ETV5, a member of the Ets family of transcription factors, plays a pivotal role in various cellular processes, including differentiation, proliferation, and apoptosis. Its expression is closely linked to several physiological and pathological conditions, particularly in cancer biology. Research has shown that ETV5 is often overexpressed in various malignancies, such as prostate cancer, where it can promote tumor progression by regulating genes involved in cellular growth and survival. Additionally, ETV5 is implicated in the epithelial-to-mesenchymal transition (EMT), a crucial mechanism in cancer metastasis. Given its significant role in tumorigenesis, understanding the structure and function of ETV5 is essential for developing targeted therapies. Recent studies have focused on the recombinant expression of ETV5 to investigate its functional domains and interaction with other molecular players in tumorigenesis. This research aims to elucidate the exact mechanisms by which ETV5 influences cancer progression and to explore its potential as a therapeutic target. By generating ETV5 recombinant proteins, researchers can perform in-depth analyses, including binding affinity studies and functional assays, to enhance our understanding of its regulatory roles in gene expression and tumor behavior. This ongoing research underscores the importance of ETV5 in cancer biology and its potential in designing innovative strategies for cancer treatment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US