Analytical Data
-
Gene name
OR1M1
- Application
-
Alternative Names
OR1M1; Olfactory receptor 1M1; Olfactory receptor 19-6; OR19-6; Olfactory receptor OR19-5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGA1
-
Expression Region
1-313 aa
-
AA Sequence
MEPRNQTSASQFILLGLSEKPEQETLLFSLFFCMYLVMVVGNLLIILAISIDSHLHTPMY FFLANLSLVDFCLATNTIPKMLVSLQTGSKAISYPCCLIQMYFFHFFGIVDSVIIAMMAY DRFVAICHPLHYAKIMSLRLCRLLVGALWAFSCFISLTHILLMARLVFCGSHEVPHYFCD LTPILRLSCTDTSVNRIFILIVAGMVIATPFVCILASYARILVAIMKVPSAGGRKKAFST CSSHLSVVALFYGTTIGVYLCPSSVLTTVKEKASAVMYTAVTPMLNPFIYSLRNRDLKGA LRKLVNRKITSSS
-
Molecular Weight
34.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR1M1 is a member of the olfactory receptor gene family, which plays a crucial role in the detection of odor molecules, thereby influencing various aspects of sensory perception and behavior. Research into OR1M1 has gained significant attention due to its potential implications in understanding olfactory signaling pathways and their associated physiological processes. Given that olfactory receptors are G-protein coupled receptors (GPCRs), they are vital for the transduction of smell signals in the nasal epithelium, which can impact areas such as taste, appetite regulation, and even memory. Despite the importance of olfactory receptors in these domains, the study of OR1M1, specifically regarding its structure-function relationship and signaling mechanisms, remains limited. This gap in research presents an exciting opportunity for scientists to isolate and characterize OR1M1 recombinant proteins. By studying its molecular makeup and functional activities, researchers aim to elucidate how OR1M1 operates in olfactory signaling, how it interacts with specific odorants, and its potential role in influencing sensory experiences. Understanding OR1M1 at the protein level could yield insights into not only the fundamental biology of olfaction but also its broader implications in human health and behavior, including neurological disorders linked to olfactory dysfunction. Thus, the investigation of OR1M1 as a recombinant protein holds significant potential for advancing our knowledge of olfactory receptors and their contributions to sensory biology.











