Cat: PA2000-9890

Recombinant Human OR1M1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OR1M1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OR1M1; Olfactory receptor 1M1; Olfactory receptor 19-6; OR19-6; Olfactory receptor OR19-5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NGA1

  • Expression Region

    1-313 aa

  • AA Sequence

    MEPRNQTSASQFILLGLSEKPEQETLLFSLFFCMYLVMVVGNLLIILAISIDSHLHTPMY FFLANLSLVDFCLATNTIPKMLVSLQTGSKAISYPCCLIQMYFFHFFGIVDSVIIAMMAY DRFVAICHPLHYAKIMSLRLCRLLVGALWAFSCFISLTHILLMARLVFCGSHEVPHYFCD LTPILRLSCTDTSVNRIFILIVAGMVIATPFVCILASYARILVAIMKVPSAGGRKKAFST CSSHLSVVALFYGTTIGVYLCPSSVLTTVKEKASAVMYTAVTPMLNPFIYSLRNRDLKGA LRKLVNRKITSSS

  • Molecular Weight

    34.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OR1M1 is a member of the olfactory receptor gene family, which plays a crucial role in the detection of odor molecules, thereby influencing various aspects of sensory perception and behavior. Research into OR1M1 has gained significant attention due to its potential implications in understanding olfactory signaling pathways and their associated physiological processes. Given that olfactory receptors are G-protein coupled receptors (GPCRs), they are vital for the transduction of smell signals in the nasal epithelium, which can impact areas such as taste, appetite regulation, and even memory. Despite the importance of olfactory receptors in these domains, the study of OR1M1, specifically regarding its structure-function relationship and signaling mechanisms, remains limited. This gap in research presents an exciting opportunity for scientists to isolate and characterize OR1M1 recombinant proteins. By studying its molecular makeup and functional activities, researchers aim to elucidate how OR1M1 operates in olfactory signaling, how it interacts with specific odorants, and its potential role in influencing sensory experiences. Understanding OR1M1 at the protein level could yield insights into not only the fundamental biology of olfaction but also its broader implications in human health and behavior, including neurological disorders linked to olfactory dysfunction. Thus, the investigation of OR1M1 as a recombinant protein holds significant potential for advancing our knowledge of olfactory receptors and their contributions to sensory biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US