Analytical Data
-
Gene name
OR1N1
- Application
-
Alternative Names
OR1N1; OR1N3; Olfactory receptor 1N1; Olfactory receptor 1-26; OR1-26; Olfactory receptor 1N3; Olfactory receptor OR9-22
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGS0
-
Expression Region
1-311 aa
-
AA Sequence
MENQSSISEFFLRGISAPPEQQQSLFGIFLCMYLVTLTGNLLIILAIGSDLHLHTPMYFF LANLSFVDMGLTSSTVTKMLVNIQTRHHTISYTGCLTQMYFFLMFGDLDSFFLAAMAYDR YVAICHPLCYSTVMRPQVCALMLALCWVLTNIVALTHTFLMARLSFCVTGEIAHFFCDIT PVLKLSCSDTHINEMMVFVLGGTVLIVPFLCIVTSYIHIVPAILRVRTRGGVGKAFSTCS SHLCVVCVFYGTLFSAYLCPPSIASEEKDIAAAAMYTIVTPMLNPFIYSLRNKDMKGALK RLFSHRSIVSS
-
Molecular Weight
34.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR1N1 protein is a member of the olfactory receptor family, primarily involved in the detection of odorants. The study of OR1N1, along with other olfactory receptors, has gained traction due to the growing understanding of their roles not only in smell but also in various physiological processes, including neurogenesis, immune response, and potential implications in cancer biology. Recent research has highlighted that certain olfactory receptors, including OR1N1, can be expressed in non-olfactory tissues, suggesting they may serve functions beyond sensory perception. The investigation of OR1N1 recombinant protein aims to elucidate its structure-function relationships, which could unveil mechanisms of action and interaction with ligands. This scrutinization is crucial for understanding how OR1N1 contributes to homeostasis and its potential therapeutic applications. Additionally, studying recombinant OR1N1 facilitates insights into drug design, where modulation of olfactory receptors might influence complex biological pathways. Such exploratory research is essential as it may lead to novel strategies for treating diseases linked to altered olfactory receptor activity, thus bridging the gap between basic olfactory science and clinical applications.
