Cat: PA2000-9875

Recombinant Human OR12D2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OR12D2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OR12D2; Olfactory receptor 12D2; Hs6M1-20; Olfactory receptor OR6-28

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P58182

  • Expression Region

    1-307 aa

  • AA Sequence

    MLNTTSVTEFLLLGVTDIQELQPFLFVVFLTIYFISVTGNGAVLMIVISDPRLHSLMYFF LGNLSYLDICYSTVTLPKMLQNFLSTHKAISFLGCISQLHFFHSLGSTESMLFAVMAFDL SVAICKPLRYTVIMNPQLCTQMAITIWVIGFFHALLHSVMTSRLNFCGSNRIHHFLCDIK PLLKLACGNTELNQWLLSTVTGTIAMGPFFLTLLSYFYIITYLFFKTRSCSMLCKALSTC ASHFMVVILFYAPVLFTYIHPALESFMDQDRIVAIMYTVVTPVLNPLIYTLRNKEVKGAL GRVIRRL

  • Molecular Weight

    34.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The OR12D2 protein, a member of the olfactory receptor family, has garnered interest due to its role in the sensory perception of odors, which plays a crucial role in numerous biological processes, including behavior, memory, and food choice. Olfactory receptors are G-protein-coupled receptors located primarily in the olfactory epithelium, where they bind to specific odorant molecules and initiate a signal transduction cascade that results in the sensation of smell. The study of OR12D2 is particularly significant as it may provide insights into the molecular mechanisms underlying olfactory signaling and its variations among individuals. Furthermore, understanding the structure and function of OR12D2 can aid in the development of novel therapeutic strategies for olfactory dysfunction and related disorders. Recent advancements in recombinant protein technology allow for the expression and purification of OR12D2, facilitating comprehensive functional studies and enabling researchers to explore its ligand preferences and downstream signaling pathways. This research has broader implications for understanding not only human olfaction but also evolutionary biology, as olfactory receptors are highly diverse and have evolved to adapt to different ecological niches. Consequently, the exploration of OR12D2 at a molecular level can contribute to a greater comprehension of olfactory receptor evolution and its impact on sensory biology across species. This knowledge is pivotal in fields ranging from neuroscience to pharmacology, where elucidating the mechanisms of sensory perception can influence drug design and environmental interactions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US