Analytical Data
-
Gene name
OR12D2
- Application
-
Alternative Names
OR12D2; Olfactory receptor 12D2; Hs6M1-20; Olfactory receptor OR6-28
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P58182
-
Expression Region
1-307 aa
-
AA Sequence
MLNTTSVTEFLLLGVTDIQELQPFLFVVFLTIYFISVTGNGAVLMIVISDPRLHSLMYFF LGNLSYLDICYSTVTLPKMLQNFLSTHKAISFLGCISQLHFFHSLGSTESMLFAVMAFDL SVAICKPLRYTVIMNPQLCTQMAITIWVIGFFHALLHSVMTSRLNFCGSNRIHHFLCDIK PLLKLACGNTELNQWLLSTVTGTIAMGPFFLTLLSYFYIITYLFFKTRSCSMLCKALSTC ASHFMVVILFYAPVLFTYIHPALESFMDQDRIVAIMYTVVTPVLNPLIYTLRNKEVKGAL GRVIRRL
-
Molecular Weight
34.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR12D2 protein, a member of the olfactory receptor family, has garnered interest due to its role in the sensory perception of odors, which plays a crucial role in numerous biological processes, including behavior, memory, and food choice. Olfactory receptors are G-protein-coupled receptors located primarily in the olfactory epithelium, where they bind to specific odorant molecules and initiate a signal transduction cascade that results in the sensation of smell. The study of OR12D2 is particularly significant as it may provide insights into the molecular mechanisms underlying olfactory signaling and its variations among individuals. Furthermore, understanding the structure and function of OR12D2 can aid in the development of novel therapeutic strategies for olfactory dysfunction and related disorders. Recent advancements in recombinant protein technology allow for the expression and purification of OR12D2, facilitating comprehensive functional studies and enabling researchers to explore its ligand preferences and downstream signaling pathways. This research has broader implications for understanding not only human olfaction but also evolutionary biology, as olfactory receptors are highly diverse and have evolved to adapt to different ecological niches. Consequently, the exploration of OR12D2 at a molecular level can contribute to a greater comprehension of olfactory receptor evolution and its impact on sensory biology across species. This knowledge is pivotal in fields ranging from neuroscience to pharmacology, where elucidating the mechanisms of sensory perception can influence drug design and environmental interactions.











