Analytical Data
-
Gene name
OR11L1
- Application
-
Alternative Names
OR11L1; Olfactory receptor 11L1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGX0
-
Expression Region
1-322 aa
-
AA Sequence
MEPQNTSTVTNFQLLGFQNLLEWQALLFVIFLLIYCLTIIGNVVIITVVSQGLRLHSPMY MFLQHLSFLEVWYTSTTVPLLLANLLSWGQAISFSACMAQLYFFVFLGATECFLLAFMAY DRYLAICSPLRYPFLMHRGLCARLVVVSWCTGVSTGFLPSLMISRLDFCGRNQINHFFCD LPPLMQLSCSRVYITEVTIFILSIAVLCICFFLTLGPYVFIVSSILRIPSTSGRRKTFST CGSHLAVVTLYYGTMISMYVCPSPHLLPEINKIISVFYTVVTPLLNPVIYSLRNKDFKEA VRKVMRRKCGILWSTSKRKFLY
-
Molecular Weight
36.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR11L1 is a member of the olfactory receptor (OR) gene family, which plays a critical role in the sensory perception of smell in mammals. Recent research has highlighted its potential involvement not only in olfaction but also in various physiological processes, including the modulation of inflammatory responses and potential implications in cancer biology. The OR11L1 protein, being a G protein-coupled receptor (GPCR), has drawn attention due to its ability to interact with a variety of ligands, thereby activating intracellular signaling pathways that could influence cellular behavior. Understanding the function and mechanism of OR11L1 is crucial for elucidating its biological roles, particularly in the context of neurobiology and immune response. Given the complexity of GPCRs and their widespread effects in the body, generating recombinant OR11L1 protein offers valuable insights into its structure-function relationships and potential therapeutic applications. Various methods, including heterologous expression systems, have been employed to produce this protein for in vitro studies, enabling researchers to investigate its ligand binding properties, cellular signaling mechanisms, and implications for health and disease. The characterization of OR11L1 can also pave the way for novel pharmacological targets and the development of new therapeutic strategies in treating disorders linked to olfactory dysfunction and other related diseases. Continued exploration of OR11L1 holds promise for advancing our understanding of GPCRs and their roles in human physiology, thus contributing to the broader field of molecular biology and pharmacology.
