Analytical Data
-
Gene name
OR10T2
- Application
-
Alternative Names
OR10T2; Olfactory receptor 10T2; Olfactory receptor OR1-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGX3
-
Expression Region
1-314 aa
-
AA Sequence
MRGFNKTTVVTQFILVGFSSLGELQLLLFVIFLLLYLTILVANVTIMAVIRFSWTLHTPM YGFLFILSFSESCYTFVIIPQLLVHLLSDTKTISFMACATQLFFFLGFACTNCLLIAVMG YDRYVAICHPLRYTLIINKRLGLELISLSGATGFFIALVATNLICDMRFCGPNRVNHYFC DMAPVIKLACTDTHVKELALFSLSILVIMVPFLLILISYGFIVNTILKIPSAEGKKAFVT CASHLTVVFVHYGCASIIYLRPKSKSASDKDQLVAVTYTVVTPLLNPLVYSLRNKEVKTA LKRVLGMPVATKMS
-
Molecular Weight
35.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR10T2 is a member of the olfactory receptor (OR) gene family, which is primarily responsible for the detection of odorant molecules in the environment. As a part of the G protein-coupled receptor (GPCR) superfamily, OR10T2 plays a crucial role in the olfactory system, contributing to the sensory perception of smells. Given the complexity of olfactory signaling and the large diversity of olfactory receptors, the study of OR10T2 and its functional characteristics is essential for understanding the mechanisms underlying olfactory transduction. Furthermore, recent studies have suggested that certain olfactory receptors, including OR10T2, may also have roles beyond smell, potentially influencing various physiological processes. The recombinant expression of OR10T2 allows for detailed investigations into its structure, ligand-binding properties, and signaling pathways, paving the way for uncovering its involvement in both sensory and non-sensory functions. This research is not only significant for the field of sensory biology but also has potential implications for developing novel therapies targeting olfactory-related disorders and enhancing our understanding of human sensory perception.
