Analytical Data
-
Gene name
SNX3
- Application
-
Alternative Names
SNX3;Sorting nexin-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60493
-
Expression Region
1-162aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAETVADTRRLITKPQNLNDAYGPPSNFLE IDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRRYSDFEWLRSE LERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVA GHPLAQNERCLHMFLQDEIIDKSYTPSKIRHA
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SNX3, a member of the sorting Nexin family, plays a crucial role in intracellular trafficking and membrane dynamics by mediating the endosomal pathway. This protein contains a phosphoinositide-binding PX domain and a clathrin-binding domain, which enable it to interact with various cellular membranes and proteins. Recent studies have suggested that SNX3 is implicated in several important cellular processes, including receptor recycling, autophagy, and the regulation of signaling pathways. Aberrant expression or dysfunction of SNX3 has been associated with various diseases, including cancer and neurodegenerative disorders. Given its pivotal role in cellular transport mechanisms and potential links to pathologies, the recombinant expression of SNX3 protein is essential for elucidating its structure-function relationships and understanding its biological significance. Investigating the functional characteristics of SNX3 through recombinant protein studies offers insights into its mechanisms and interactions, paving the way for potential therapeutic applications and targeted interventions in diseases related to its dysregulation. The recombinant SNX3 protein can serve as a valuable tool for studying its effects on cellular processes, evaluating its interactions with other proteins, and exploring its potential as a biomarker or therapeutic target in relevant diseases. Therefore, the development and characterization of SNX3 recombinant protein are of significant interest for both basic research and potential clinical applications.











