Analytical Data
-
Gene name
ACTR1B
- Application
-
Alternative Names
Actin related Protein 1B; Actin-related Protein 1B; ACTR 1B; ACTR1B; ACTY_HUMAN; ARP 1B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42025
-
Expression Region
1-376aa
-
AA Sequence
MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVLSGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF
-
Molecular Weight
68.7 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACTR1B, a member of the actin-related protein family, plays a crucial role in cytoskeletal dynamics and intracellular transport. It is an essential component of the dynactin complex, which assists dynein motor proteins in transporting cellular cargos along microtubules. Recent studies have linked ACTR1B to various cellular processes, including mitosis, neuronal function, and the maintenance of cell shape. Mutations or dysregulation of ACTR1B have been implicated in several diseases, particularly neurodegenerative disorders and certain forms of cancer. The recombinant expression of ACTR1B allows researchers to study its structural and functional properties in detail, facilitating a better understanding of its role in cellular mechanisms. Such studies are critical for unraveling the complexities of cellular transport and might pave the way for developing therapeutic strategies targeting ACTR1B-related pathways. Through techniques such as X-ray crystallography and cryo-electron microscopy, scientists aim to elucidate the molecular interactions and conformational changes of ACTR1B within the dynactin complex and its interactions with dynein, enhancing our knowledge of its biological significance. Overall, the investigation of ACTR1B as a recombinant protein is vital for advancing our understanding of cytoskeletal dynamics and its implications in health and disease.
