Analytical Data
-
Gene name
OPRK1
- Application
-
Alternative Names
OPRK1; OPRK; Kappa-type opioid receptor; K-OR-1; KOR-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P41145
-
Expression Region
1-58 aa
-
AA Sequence
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAI
-
Molecular Weight
32.12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OPRK1 gene encodes the kappa-opioid receptor (KOR), a member of the opioid receptor family that plays a crucial role in modulating pain, mood, and addiction pathways in the central nervous system. KORs have garnered significant interest in pharmacology and neuroscience due to their potential therapeutic applications in managing pain, substance use disorders, and mood disorders. Unlike mu-opioid receptors, which are primarily associated with analgesia and the risk of addiction, KOR activation has been shown to elicit dysphoria and anxiety in some contexts, making it a unique target for drug development. The production of recombinant OPRK1 protein is essential for studying the receptor's structure, function, and potential drug interactions. Advances in recombinant DNA technology have enabled the expression of OPRK1 in various systems, facilitating high-throughput screening of novel ligands that could lead to the development of safer analgesics with reduced addictive properties. Understanding the biological mechanisms underlying KOR signaling and its interaction with different ligands holds promise for discovering new treatment avenues for challenging mental health and pain-related disorders. As research progresses, insightful findings from studies involving recombinant OPRK1 protein may contribute to the design of innovative therapeutics that harness the beneficial aspects of KOR activity while mitigating adverse effects associated with opioid use.
