Cat: PA1000-2967

Recombinant Human SNAPC1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SNAPC1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SNAPC3;SNAP50;snRNA-activating Protein complex subunit 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16533

  • Expression Region

    1-368aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMGTPPGLQTDCEALLSRFQETDSVRFE DFTELWRNMKFGTIFCGRMRNLEKNMFTKEALALAWRYFLPPYTFQIRVG ALYLLYGLYNTQLCQPKQKIRVALKDWDEVLKFQQDLVNAQHFDAAYIFR KLRLDRAFHFTAMPKLLSYRMKKKIHRAEVTEEFKDPSDRVMKLITSDVL EEMLNVHDHYQNMKHVISVDKSKPDKALSLIKDDFFDNIKNIVLEHQQWH KDRKNPSLKSKTNDGEEKMEGNSQETERCERAESLAKIKSKAFSVVIQAS KSRRHRQVKLDSSDSDSASGQGQVKATRKKEKKERLKPAGRKMSLRNKGN VQNIHKEDKPLSLSMPVITEEEENESLSGTEFTASKKRRKH

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SNAPC1, or Small Nuclear RNA Activating Protein Complex 1, is a crucial component of the small nuclear ribonucleoprotein (snRNP) complex, playing a pivotal role in the maturation and processing of precursor messenger RNA. Research on SNAPC1 has gained prominence due to its essential function in the transcription regulation of small nuclear RNAs, particularly those involved in spliceosome assembly. The proper functioning of SNAPC1 is vital for maintaining cellular homeostasis, as disruptions in its activity can lead to aberrant gene expression and have been implicated in various diseases, including cancer. Recent studies have focused on understanding the structural properties and molecular mechanisms of SNAPC1, aiming to elucidate how it interacts with other components of the spliceosomal machinery. Insights into SNAPC1's role in RNA processing not only enhance our comprehension of fundamental biological processes but also open avenues for therapeutic interventions targeting its dysfunctions. As such, SNAPC1 serves as a significant model in the broader fields of molecular biology and genetics, warranting continued investigation into its diverse functions and regulatory pathways.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US