Cat: PA1000-2915

Recombinant Human SH3GLB1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SH3GLB1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SH3GLB1;KIAA0491;Endophilin-B1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y371

  • Expression Region

    1-365aa

  • AA Sequence

    MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAE CTKIWTEKIMKQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQY MIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNF IEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQS EFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQK QLGSFPSNYLSNNNQTSVTPVPSVLPNAIGSSAMASTSGLVITSPSNLSD LKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERG NQKGKVPITYLELLNLEHHHHHH

  • Molecular Weight

    42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SH3GLB1, also known as SH3-domain-containing GRB2-like protein 1, is a crucial player in cellular processes such as endocytosis, membrane trafficking, and actin cytoskeleton remodeling. This protein contains a Src homology 3 (SH3) domain, suggesting its involvement in protein-protein interactions that regulate various signaling pathways. Research on SH3GLB1 has gained momentum due to its potential implications in several diseases, including cancer and neurodegenerative disorders. Its role in the regulation of vesicle formation and endosomal machinery has made it a focus for understanding the mechanisms of intracellular transport and signal transduction. Investigating the structure and function of SH3GLB1, especially through the development of recombinant proteins, allows scientists to elucidate its specific interactions and downstream effects in cellular physiology. Furthermore, the ability of SH3GLB1 to modulate cellular responses to external stimuli underscores its importance in maintaining cellular homeostasis. The ongoing exploration of SH3GLB1's function may provide insights into therapeutic targets, enhancing our understanding of disease mechanisms and opening new avenues for intervention. Overall, the study of SH3GLB1 and its recombinant forms serves as a critical step toward deciphering the complexities of cellular dynamics and their implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US