Cat: PA1000-2914

Recombinant Human SH3GL3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SH3GL3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SH3GL3;CNSA3;SH3D2C;Endophilin-A3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q99963

  • Expression Region

    1-347aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSVAGLKKQFHKASQLFSEKISGAEGT KLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKI RGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEV KDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGK IPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAV FIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSEL NGVSTTSVVKTTGSNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLTNQ IDENWYEGMIHGESGFFPINYVEVIVPLPQ

  • Molecular Weight

    42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SH3GL3, a member of the SH3P family, plays a crucial role in intracellular trafficking and membrane dynamics by regulating the endocytosis and recycling of membrane proteins. It contains a domain that facilitates its interaction with various proteins involved in clathrin-mediated endocytosis. Research has indicated that SH3GL3 is associated with several cellular processes, including vesicle formation and the regulation of signal transduction pathways. Abnormal expression or dysfunction of SH3GL3 has been linked to various pathologies, including neurological disorders and cancer, highlighting its potential as a therapeutic target. Consequently, the study of SH3GL3 recombinant proteins becomes vital for elucidating its functional mechanisms and interactions within the cell. Understanding SH3GL3's role could advance knowledge in cellular biology and pathology, paving the way for developing novel treatment strategies. As a model for studying endocytic pathways, SH3GL3 recombinant proteins are critically important for both basic and applied research in cell biology and may contribute to insights into disease mechanisms and the development of innovative therapeutic approaches.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US