Analytical Data
-
Gene name
DIC
- Application
-
Alternative Names
DIC；DIC；Mitochondrial dicarboxylate carrier
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBX3
-
Expression Region
1-287aa
-
AA Sequence
MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVASFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHCAVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKVPS
-
Molecular Weight
31.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DIC, or Disintegrin and Metalloproteinase with a thrombospondin type 1 motif, is a key protein involved in various physiological and pathological processes, including cell adhesion, migration, and angiogenesis. Its significance has garnered attention in the field of biomedical research, particularly in cancer biology and inflammation, where DIC plays a role in tumor progression and metastasis. The interest in recombinant DIC proteins arises from their potential therapeutic applications, such as in targeted drug delivery systems and as biomarkers for disease diagnosis. Advances in molecular cloning and protein expression technologies have allowed for the efficient production of recombinant DIC proteins, enabling detailed studies of their structure and function. Researchers are exploring various techniques to assess the biological activity of these proteins, aiming to elucidate their mechanisms and interactions within cellular environments. Furthermore, understanding the role of DIC in disease processes may facilitate the development of novel therapeutic strategies, enhancing our capacity to combat conditions linked to dysfunctional DIC activity. The growing body of literature surrounding recombinant DIC proteins underscores their potential as valuable tools in both basic research and clinical applications, marking a significant step towards exploiting their full therapeutic potential.
