Analytical Data
-
Gene name
AP3m1
- Application
-
Alternative Names
AP3m1;AP-3 complex subunit mu-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y2T2
-
Expression Region
1-418aa
-
AA Sequence
MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPPVISTPHHYLISIYRDKLFFVSVIQTEVPPLFVIEFLHRVADTFQDYFGECSEAAIKDNVVIVYELLEEMLDNGFPLATESNILKELIKPPTILRSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAYFDVVEEIDAIIDKSGSTVFAEIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHSISFKENSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLTWDVGKITPQKLPSLKGLVNLQSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYVTKAGKFQVRT
-
Molecular Weight
46.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AP3M1 (Adaptor Protein Complex 3 Mu 1) is a crucial component of the AP-3 protein complex, which is involved in intracellular trafficking and sorting of proteins to lysosomes, melanosomes, and other organelles. Recent studies have highlighted the significance of AP3M1 in various cellular processes, particularly in the context of neurodegenerative diseases and immune response. Mutations in the AP3M1 gene have been linked to conditions such as Hermansky-Pudlak Syndrome, characterized by oculocutaneous albinism and immunodeficiency, underscoring the protein's role in maintaining cellular homeostasis and normal pigment cell function. Additionally, AP3M1 has been implicated in the maintenance of synaptic activity and neuronal health, making it a promising target for understanding the molecular mechanisms underlying neurological disorders. Research into AP3M1 recombinant proteins aims to elucidate its structural and functional properties, offering insights into its role in the endosomal-lysosomal pathway and potential therapeutic avenues for related diseases. Furthermore, studying AP3M1 interactions with other proteins in the trafficking pathway could reveal novel regulatory mechanisms, contributing to our understanding of cellular signaling and organelle biogenesis. Such insights are key to developing strategies for intervention in AP3M1-related pathologies and advancing therapeutic approaches targeting intracellular transport systems.











