Cat: PA1000-2883

Recombinant Human SerpinA5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SerpinA5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SERPINA5;PCI;PLANH3;PROCI;Plasma serine protease inhibitor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P05154

  • Expression Region

    20-406aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMHRHHPREMKKRVEDLHVGATVAPSSRRDF TFDLYRALASAAPSQNIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLN LQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSA MKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNAVVI MVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDR NLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQ LELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMV HKAVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVDNNIL FLGKVNRP

  • Molecular Weight

    46 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SerpinA5, also known as Protein C Inhibitor (PCI), is a member of the serine protease inhibitor (serpin) superfamily, playing a crucial role in regulating coagulation and inflammation. Its primary function is to inhibit activated protein C (APC), a key player in the coagulation cascade, thereby preventing excessive bleeding during vascular injury. Increased levels of SerpinA5 have been linked to various pathological conditions, including thrombosis, inflammatory diseases, and cancer progression. Research has expanded to explore its dual role in both thrombosis and cancer, where it may influence tumor growth and metastatic potential. Recombinant SerpinA5 has gained attention for its potential therapeutic applications, including its use in the development of anticoagulant therapies and as a biomarker for disease prognosis. Understanding the structure-function relationship of SerpinA5 through recombinant protein studies could unveil novel approaches to modulate its activity, offering insights into the design of inhibitors or mimetics that could be beneficial in clinical settings. Furthermore, these studies provide valuable information on the molecular mechanisms underlying its interactions with proteases, paving the way for enhanced therapeutic strategies in managing diseases associated with dysregulated coagulation and inflammation. Thus, the research on recombinant SerpinA5 is pivotal for both basic biology and potential clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US