Cat: PA1000-2881

Recombinant Human SERF2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SERF2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SERF2;FAM2C;Small EDRK-rich factor 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P84101

  • Expression Region

    1-59aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMTRGNQRELARQKNMKKQSDSVKGKRR DDGLSAAARKQRDSEIMQQKQKKANEKKEEPK

  • Molecular Weight

    9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SERF2 (Small Expressed Protein 2) is a member of the SERF family, known for its role in regulating cellular processes related to protein folding and stress responses. Recent research has highlighted its significance in the modulation of cellular homeostasis, particularly under stress conditions such as oxidative stress and heat shock. SERF2 is implicated in various physiological functions, including the regulation of molecular chaperones and enhancers, thereby influencing protein quality control mechanisms. Its association with neurodegenerative diseases, cancer, and other pathologies underscores the importance of understanding SERF2's functional dynamics. The recombinant expression of SERF2 in various model systems has enabled researchers to dissect its roles at a molecular level, facilitating investigations into its interaction partners and downstream signaling pathways. The study of SERF2 as a recombinant protein is crucial for elucidating its structure-function relationships, providing insights that may lead to novel therapeutic strategies that harness its protective roles in cellular stress responses. Given the increasing interest in targeted therapies and protein-based agents in biomedical research, SERF2 emerges as a promising candidate for further exploration, potentially offering avenues for intervention in diseases characterized by protein misfolding and cellular dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US