Analytical Data
-
Gene name
ACVRL1
- Application
-
Alternative Names
GDF2;BMP9;Growth/differentiation factor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P37023
-
Expression Region
22-118aa
-
AA Sequence
DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ
-
Molecular Weight
11.5KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACVRL1, or Activin A receptor type II-like 1, is a key component of the TGF-beta superfamily of receptors, crucial for various biological processes, including vascular development, cell proliferation, and differentiation. Mutations in the ACVRL1 gene are linked to hereditary hemorrhagic telangiectasia (HHT), a genetic disorder characterized by abnormal blood vessel formation, leading to frequent nosebleeds, gastrointestinal bleeding, and arteriovenous malformations. Research on ACVRL1 recombinant proteins has gained significant attention due to their potential therapeutic applications in targeting vascular abnormalities and modulating angiogenesis. Understanding the structure and function of ACVRL1 is essential for elucidating its role in disease pathology and for developing targeted treatments for conditions associated with dysfunctional vascular system regulation. The production of recombinant ACVRL1 proteins allows for in-depth studies of receptor signaling pathways and interaction with ligands, providing insights into the molecular mechanisms underlying HHT and other vascular disorders. Moreover, recombinant ACVRL1 can serve as a valuable tool in drug screening and the identification of novel compounds that can enhance or inhibit its activity, which may lead to innovative therapeutic strategies for managing vascular-related diseases. Through these investigations, researchers aim to improve our understanding of ACVRL1’s involvement in both normal physiology and pathological conditions, ultimately contributing to the advancement of clinical interventions for patients suffering from HHT and associated vascular malformations.
